DPCstruct | MC7199
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 238 ± 17 aa |
| Standard deviation of domain lengths | 16.93 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 28.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H0GU22 | 3-228 | KFRTFRPEYESIEGMTQNSRFVDERFLNKVTSADFQRLATELQTRLDDDAIANALKRFPEPVFAQEGEYIGQALEARRAKLPWAANE… |
| A0A081DB72 | 253-495 | KPIPRDRDQAFSTFDGAILNFLNHAVPSLRMMQSFDNDLRSPKWFSFEPYPLDMTFINKSNWEDWEREAKTLETGLTDEVIERAFEN… |
| A0A6C0RA30 | 354-600 | None |
| A0A1M4Y1E7 | 258-477 | None |
| A0A4D7JRN9 | 616-859 | None |
| A0A2V7XT81 | 264-499 | None |
| A0A843SYB9 | 111-348 | None |
| A0A7C2P2V7 | 250-500 | None |
| S7VUT0 | 319-583 | None |
| A0A524KTU8 | 6-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.