DPCstruct | MC7198
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 125 ± 21 aa |
| Standard deviation of domain lengths | 20.64 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9KCS2 | 162-282 | GKWYKIGVAQTGIYRITYHDLKKWGVNPDQIDPRTISLHGFGGRLLPESNLQKTQDDLPPVAIEVIGEEDGIFNPDDYILFYGENPH… |
| A0A7H0GS98 | 11-129 | QAVAQSGPYGNEWIVPGQSYYKIRVTQDGIHRLDNQYLTRAGLSNGTDPRRLQLWRRGQEVAMYVGGNQTSLDPSTFIEFYGQRNDG… |
| A0A2J6HCI4 | 10-141 | None |
| A0A136NCM7 | 147-296 | None |
| A0A1W9SN32 | 3-161 | None |
| A0A7W0PA08 | 14-121 | None |
| A0A5R9KX98 | 31-137 | None |
| A0A1J4RGV8 | 494-595 | None |
| A0A2N2PUD7 | 288-390 | None |
| A0A4Q3SFP5 | 2-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.