DPCstruct | MC7196
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 108 ± 10 aa |
| Standard deviation of domain lengths | 9.55 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 52.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q4BUC9 | 1-102 | MESLVDLMIHTDSQERSLILEALSQISTRTLKPMNHALTLSLQDKNPQVRKNAIRDLTRIHDLMSQIYQLLCHSIEPRFRTSKCSIK… |
| A0A3C1PCG8 | 93-196 | LLELLTNSDSNQRSLVLAALSEIGSRTLKPLNRALSLSLQDENAEVRKNAIRDLTRIYDLATQMSQILQRAVDDPDPEVQEMAKWAT… |
| A0A350Y7C3 | 392-507 | None |
| A0A0P8DPE5 | 366-466 | None |
| A0A3M1SUP6 | 184-298 | None |
| A8YJI8 | 120-243 | None |
| A0A6P0JPC7 | 1-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.