DPCstruct | MC7195
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 141 ± 21 aa |
| Standard deviation of domain lengths | 20.91 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T2II51 | 8-143 | FSEIVTCCKKSPIGKQLPTALYVHISAIDSLEIILQEYEKKARLTEKIEGATIIKFATDRPTISYLFYPDFDSDPHPALTLSIVVNL… |
| K0V439 | 167-315 | NARSSKVGKQTPSALYVHKSALGELPPILQVYEGCARALSGTVEHANLVKLSVTEPQVSYLTYPEFDRKAHPTLASSVIVNLRKLTV… |
| A0A2D8IZW7 | 8-142 | None |
| A0A1Z3HVD2 | 10-167 | None |
| A0A5S4FPX0 | 193-347 | None |
| A0A848A5X9 | 206-347 | None |
| A0A850SZ73 | 6-158 | None |
| A0A6M1LU00 | 51-199 | None |
| A0A2N7IX23 | 13-155 | None |
| A0A497F8X6 | 3-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.