DPCstruct | MC7194
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 117 ± 25 aa |
| Standard deviation of domain lengths | 25.37 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 85.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10719 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A810Q907 | 137-224 | ETTCENIMQLLVEEKADQYMTLFGLCRCSRCRNDVLALALNQLPPKYVVMPVRELTPRLSIYEGRFNSAVTAQILRACKEVLEHPRHD |
| T2IC70 | 2-124 | ELLVQNEIDKQLRLYPKKIRDYINKVEVATYALNRLPPLYASSLIGKEHQKRTGMQKYKSQITLAVRRSLAAIERDPIKKTVPIRPE… |
| A0A261KND5 | 58-169 | None |
| A0A316A4J2 | 179-268 | None |
| A0A0C2UZ51 | 2-82 | None |
| A0A2W7B3E2 | 17-153 | None |
| A0A2W7B4L7 | 118-244 | None |
| A0A1V4QH06 | 2-90 | None |
| T2J8P4 | 2-132 | None |
| A0A6M8BMS1 | 4-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.