DPCstruct | MC7192
Metacluster Properties and Pfam Annotations
| Number of structural domains | 116 |
|---|---|
| Mean domain length (aa) | 363 ± 54 aa |
| Standard deviation of domain lengths | 53.60 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 24.02 |
| Pfam Score | 79.08 |
| Assigned Pfam label(s) | CL0592- CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T2IAN2 | 225-583 | GSSELTLVITYSFMTTVPNYYDIDGDSVNVDGNLATLLQPFSEDTTKFIVDALKLYSDIANIQFQEVDETANGGEGGTLNFGYAFLT… |
| A0A2R7SWB4 | 37-365 | ADQAADEILRKGLSWSDKNADGKIDLSYSFLTEKPANYNPQLGNFSEFSAQQKAQAVLAMQSWADVARVTFTEGKGGDGHMTFGNYD… |
| A0A2A4ZK11 | 276-631 | None |
| A0A840HZ29 | 17-372 | None |
| A0A7T1MFV3 | 98-509 | None |
| A0A1M4SBF4 | 362-682 | None |
| A0A418WEC2 | 7-354 | None |
| A0A4R7RKG0 | 15-367 | None |
| A0A1I3C2M4 | 11-354 | None |
| A0A839IL91 | 158-553 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.