DPCstruct | MC7191
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 149 ± 9 aa |
| Standard deviation of domain lengths | 9.28 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 46.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00617 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4C2AGM8 | 2-163 | ILRRVYTDNAFMFEAKLRPCFKSMNEGTNPLPPNTTTPNILPPVLLFHMFDGEDGGLLQPNDNFPGSLVNTLDFDFNSTTAHLEAAR… |
| A0A556VAE8 | 18-160 | VLRRNHTDSAVMFEKTLKPFMKALNEGDESVVSGLVSLPHMVPLLKLMEGEDAVENSERGCQLLYNILQSSRHIANHANDYQQHAQT… |
| A0A2K5XKV7 | 411-564 | None |
| A0A3Q2CVS0 | 708-861 | None |
| A0A7R8XH05 | 91-229 | None |
| A0A5C6N1G2 | 252-403 | None |
| A0A672L6N6 | 65-218 | None |
| A0A4Z2HXW3 | 236-389 | None |
| A0A6P4I0Y0 | 2-133 | None |
| A0A4S2KHQ1 | 1023-1178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.