DPCstruct | MC7189
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 97 ± 11 aa |
| Standard deviation of domain lengths | 11.42 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 52.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4C1TE87 | 117-215 | VALEERILRTMRKLSKENDQDYSETFTDWETPKITWIKGVPGCGKTTWIVQEFDNKRDCIVTATIEAAEDLKLKLANRIGAEATTRV… |
| A0A4C1UY10 | 118-207 | ALEERILRTMRKLSKENDQDYSETFTDWKTPKITWINGVPGCGKTRWIVQEFDKKRNCIVTTDIEAAEDLKGKLANRIGAEATTRVR… |
| A0A2W1BNQ4 | 169-267 | None |
| A0A4C1TVX1 | 3-82 | None |
| A0A4C1WZM7 | 184-292 | None |
| A0A4C1WRF6 | 3-91 | None |
| A0A4C1Y6A3 | 187-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.