DPCstruct | MC7182
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 180 ± 44 aa |
| Standard deviation of domain lengths | 44.11 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 73.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0255 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060T8P2 | 2-117 | DDVWEEEGPAPSSTTRVEREHHNAGYVEGITASKEKWLQPGFDGGYPTGAVLGMQVGQIIGTLQGLGLRDIETKATSDLSIENIYSS… |
| A0A1B5KV37 | 1-181 | MMELDTRLEQLDDVFGSASASLLEHEVTDLHPSDMHRLETEHATAGYREGVTAAKGLTVQAGFDEGFSLGSAIGLRAGQLLGMMEGI… |
| A0A2T0FJ86 | 1-114 | None |
| A0A367L6A2 | 5-157 | None |
| A0A1V8SBH8 | 3-220 | None |
| A0A2B7X4M0 | 17-238 | None |
| A0A0G4LUN3 | 181-383 | None |
| A0A4U0WIW5 | 3-251 | None |
| A0A5N6TP17 | 2-187 | None |
| A0A2V1AUG8 | 9-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.