DPCstruct | MC7181
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 159 ± 27 aa |
| Standard deviation of domain lengths | 26.54 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.71 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.57 |
| Pfam Score | 97.83 |
| Assigned Pfam label(s) | PF18126- CL0184 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A167E232 | 112-260 | ASAAKCVQLARALPEPLQRFFARWPPASIQSADAAPTSYQEQRPDPFRFCKHPVTGKWQDPVYSYRRQAQLVRLAREHGVEDLLPET… |
| A0A1B5KSF9 | 43-198 | LESKTMASAAKYIQLAKTLPPPLQRFFARWPPASLQPAGSPPTRHQEQRPDPFRSHEHPVTGKWHDAAYSCRRQAQLVRLAREHGVE… |
| A0A086TF56 | 11-153 | None |
| A0A0F7SRH9 | 79-277 | None |
| A0A1Z5T2R0 | 4-196 | None |
| A0A836AL95 | 47-256 | None |
| A0A0G4KDR5 | 2-168 | None |
| A0A2V1AE02 | 1-115 | None |
| J7SBX7 | 6-184 | None |
| A0A427YW61 | 8-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.