DPCstruct | MC7180
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 162 ± 16 aa |
| Standard deviation of domain lengths | 15.65 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D5UXQ1 | 11-175 | RTRFTQPPEVLSGTPVISCPLVRLPTEVLLRIFQEADPIDAVCLALASKRLVQVSAMLKIRVPSVAKHRYTLPSSCDEIYQLIRRFQ… |
| A0A063CAU7 | 97-265 | TDAAPAGLEMDAEAQLLQQPQAAQPSRLLALPNELLLQILTHAGSVDRMLLALTCKRLLAVSFMTVTMIPSASRHHAYQLNCRAMLD… |
| A0A086SV53 | 1-160 | None |
| A0A086T449 | 267-438 | None |
| W6Q165 | 20-167 | None |
| A0A2S4KME4 | 21-187 | None |
| A0A438NE12 | 61-248 | None |
| A0A4Q7JUD5 | 32-218 | None |
| A0A094GI21 | 97-244 | None |
| A0A2C6AJS1 | 32-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.