DPCstruct | MC7179
Metacluster Properties and Pfam Annotations
| Number of structural domains | 147 |
|---|---|
| Mean domain length (aa) | 143 ± 27 aa |
| Standard deviation of domain lengths | 26.97 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 17.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| P16412 | 4-102 | TTCSSKPYSAQQVRAAANAACQYYQSNDTAGSTTYPHTYHNYEGFDFAVNGPYQEYPIRTSGVYSGGSPGADRVIINTQCQFAGAIT… |
| A0A063CAK7 | 9-125 | FFLSLIAIVAAAGHSAVCGNRQYSTDAVAKASDASCSYVKNGTSVGTNMYPHQYKNLEKLNLGGLSGPFYEFPILSNGQVYFSGNPG… |
| A0A0L1JGX2 | 7-171 | None |
| A0A0F7ZNA5 | 9-130 | None |
| A0A0F8A3I9 | 4-133 | None |
| A0A0A1SVH6 | 3-125 | None |
| A0A5N6TJK6 | 16-183 | None |
| A0A319D7C5 | 9-132 | None |
| A0A420SAF6 | 269-419 | None |
| A0A507QV62 | 301-415 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.