DPCstruct | MC7178
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 100 ± 8 aa |
| Standard deviation of domain lengths | 8.37 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 42.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A855HEZ8 | 202-308 | MFAQANSEHCRHKIFGSEWTIDGEKQPLSLFQMIKNTYKESPDEVLSAYKDNASVIVGYDTQRFYPKKDNETGHFIYKYKSQAAHIL… |
| A0A063C4E1 | 1-89 | MVDSRHCRHKVFNASWTIDGVKKDKSLFEMIRNTHKKTPDYTVSAYSDNAAVLQGEPAHFWAPDYSTGTWTLTPEVAHILAKVEVNL… |
| A0A2R2MP78 | 232-339 | None |
| A0A177VIQ6 | 135-219 | None |
| A0A813GTL8 | 216-321 | None |
| X0Q618 | 174-283 | None |
| A0A7J6Z5R7 | 336-442 | None |
| M2SLC5 | 587-688 | None |
| A0A1I7XAG5 | 319-412 | None |
| A0A368HBJ1 | 217-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.