DPCstruct | MC7176
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 144 ± 14 aa |
| Standard deviation of domain lengths | 14.31 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N2AVA1 | 269-407 | HGIVPPFLLERIAAAPTAAAAVAERTLRLDGGIRVERGVRAERAATARPAGAQQRPTLVPDEAAPDRTVSDAKGTTTLPGTAVRGEG… |
| A0A2N0FPQ4 | 1-127 | MCKTKCQIIPPHILEELAKRGNVSCKKTLNDTGRIAERRQTALNHLLLRNPILGDGDRFVYDCENKYEQRVTLVRKENGEVTGDVTA… |
| A0A3S4EWH5 | 1-134 | None |
| A0A2T4V8P4 | 8-136 | None |
| A0A6N3RVV3 | 1-138 | None |
| A0A4P7F323 | 1-145 | None |
| A0A505HZF2 | 9-138 | None |
| A0A2G6Y0D3 | 5-151 | None |
| A0A3M5CBX3 | 1-142 | None |
| A0A098DD37 | 2-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.