DPCstruct | MC7175
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 74 ± 5 aa |
| Standard deviation of domain lengths | 5.25 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 38.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V4A322 | 57-133 | CDSPWLLIKDSIEGMKGIKSKVDFVLWTGDNIAHIKDENLTLEMNIDSINNITNELKRNFPGIKVYATLGNHDYLPN |
| A0A817HPX5 | 641-716 | NCDIPFWTVQTILQYASELEDFDFIYYTGDLPPHNVWNQSRADQLYAIKTINQLLATTFPNKTFYPAVGNHEAAPC |
| A0A6L5CM00 | 561-617 | None |
| A0A653BV47 | 164-241 | None |
| V5ICD7 | 233-309 | None |
| A0A7M7N2M6 | 251-325 | None |
| A0A0N5CTP0 | 29-106 | None |
| A0A7R9KG10 | 211-287 | None |
| A0A6H5I6L3 | 280-357 | None |
| A0A7M5X4X9 | 420-489 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.