DPCstruct | MC7174
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 107 ± 4 aa |
| Standard deviation of domain lengths | 3.85 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 93.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 60.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00285 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7CLY8 | 1-110 | PRYTAQLDFAKRYIEKDDLIDTVHMIYEVVPPVLKSIGKIKNPWPNVDAHSGALLVHYGMEEYDFYTVLFGVSRALGVLAQLTWDRA… |
| A0A063BWX4 | 1-97 | MPEDPMFKLVSQVYKIAPGVLTEHGKTKNPYPNVDAHSGVLLQHYGLTQASYYTVLFGVSRAIGVLPQLIIDRAVGAPIERPKSFST… |
| A0A445GYV0 | 680-787 | None |
| A0A2K6G686 | 281-380 | None |
| A0A674HNA0 | 518-625 | None |
| A0A1J1IJG4 | 657-764 | None |
| A0A444F7W7 | 84-192 | None |
| A0A818L1M6 | 60-167 | None |
| A0A7Y2C2J4 | 48-155 | None |
| A0A556V2G4 | 357-464 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.