DPCstruct | MC7166
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 101 ± 13 aa |
| Standard deviation of domain lengths | 12.78 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.46 |
| Pfam Score | 90.91 |
| Assigned Pfam label(s) | CL0167- CL0186- CL0366 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7KPS4 | 32-139 | TNLSTYCAEYSLNEFLEQATNFHFLLYLMTNHLVQFSEAEMHKLCFAVSTQNREMAIEWARETLDWQQLVALSHEQGHAAASATTWS… |
| A0A7J7T7K4 | 6-110 | ISDFHLLLFLVTNEVMPLQDSISLLLEAVRTRNEELAQTWKKSEQWATIEQLCSTVGVQLPGLQEYGAVGGSSHAAAAAMWACEHCT… |
| A0A1B6E2U5 | 28-126 | None |
| A0A4C1XHV0 | 149-240 | None |
| A0A182QCF1 | 108-214 | None |
| A0A0B1PGK8 | 2-105 | None |
| A0A820LME0 | 2-84 | None |
| W5JKZ6 | 116-210 | None |
| A0A7R9AQH7 | 967-1077 | None |
| A0A834IL58 | 160-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.