DPCstruct | MC7165
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 80 ± 12 aa |
| Standard deviation of domain lengths | 11.64 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 91.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 33.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2EDD6 | 8-83 | DPATADLSPRDRAMVDYAVKLTLSPGAMEPGDLDRLRDQGFEDEAILWLAEVVGYFNYVNRMADGLGVTLEPGKWD |
| A0A381UII7 | 2-63 | LDYAVKLTRTPGDMERADVDALRAAGFSDRDVLDLAEVTAYYAYANRIADGLGITTEDWIPE |
| A0A3C1EEJ5 | 1-91 | None |
| A0A1Q4D8C1 | 84-184 | None |
| A0A2E1CVS1 | 93-157 | None |
| A0A534V0R6 | 1-86 | None |
| A0A841GG10 | 1-95 | None |
| A0A7K2EAH9 | 11-107 | None |
| A0A7X5VM64 | 1-64 | None |
| A0A5N9BMU5 | 13-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.