DPCstruct | MC7163
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 96 ± 9 aa |
| Standard deviation of domain lengths | 8.55 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V3S227 | 66-154 | AGGPVQKGAQFQKPSVFDVAPTILYLMGLPLARDMPGRAWTEVLSQEFVNSHPVRTIESYGTYTPPPPPVSTPEQDKDILKHLKALG… |
| A0A7Y2E9S9 | 3-89 | FTFSGHHHMQGILIANGPMFLKGEVEARQSLLDIAPTLLYLAGLPVPSYMEGNVLEAWFDPTYLERNPVTFSGEKARETGGPNELIP |
| X1VCH2 | 2-94 | None |
| A0A0S8G289 | 56-145 | None |
| A0A3M1HY76 | 162-253 | None |
| A0A2D5AWC9 | 368-466 | None |
| A0A1F7RSA9 | 839-927 | None |
| A0A538ST97 | 1-87 | None |
| A0A7W0SB70 | 331-417 | None |
| A0A661VMS9 | 101-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.