DPCstruct | MC7162
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 657 ± 123 aa |
| Standard deviation of domain lengths | 123.44 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.26 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0291- CL0260- CL0237 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5C778 | 72-625 | GQRRGAAPIPINRRFQVYKGFLETTGADVFRRYPSALLELFLVLQEHPEIQGVRAGTVRLIRQHRHRIDDAYRKDLRNRSLFMEILR… |
| A0A7V2F3S6 | 68-808 | GHSVRSPAELRRAIRTDLDLKTALLDGRWLCGDEALKADLGLLKSMVRETEGGELLEGKLAETRRRWDKYGGSYHLIEPNIKESPGG… |
| A0A2V6R644 | 518-1273 | None |
| A0A3D3VQJ5 | 16-500 | None |
| A0A2V8UE77 | 17-566 | None |
| A0A6J4JEX8 | 233-910 | None |
| A0A538CAJ6 | 4-659 | None |
| A0A831KCF5 | 10-561 | None |
| A0A4P0UAT0 | 446-1204 | None |
| A0A7C2I7H4 | 4-458 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.