DPCstruct | MC7161
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 283 ± 32 aa |
| Standard deviation of domain lengths | 31.69 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0179 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A351X560 | 2-252 | REMLRLLEKNYEAPVDLEFTFSVHDDPQGKPELCITILQCRPQSQLQSTAATALPYEPDPKDVIFETRFVVPEGYLERVDYVVFVPP… |
| A0A7V2AW70 | 74-326 | MTFEGLLNDTSFIKKVRAILNVLEKTINTPVDIEFAHDGTDFYLLQCRPQSYSQDTAPAPIPKDMPEENIVFSANRHVSNGRVPDIT… |
| A0A3M1VQM6 | 485-819 | None |
| A0A173Z7V1 | 46-303 | None |
| A0A8B5WWQ2 | 643-918 | None |
| H9UL02 | 547-858 | None |
| A0A843EQS5 | 79-396 | None |
| A0A7X8QVR3 | 431-721 | None |
| A0A5E4LK04 | 281-596 | None |
| A0A3M2G1B6 | 804-1120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.