DPCstruct | MC7160
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 213 ± 20 aa |
| Standard deviation of domain lengths | 20.39 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 17.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V1Z2I8 | 31-255 | GDRALFRLGSVLGVLGVLLVLVMEGFLHPSRAHPNDSHAAFREYAASGSFTSIHVADFVGTFCIVVALVALYRSVAPEGGWPRACAT… |
| A0A538UE66 | 4-228 | TRSLARRAGLLYVLASSTAPFCYLYVPDALIVKADALATADRVRASEGLLRAAIVGELYCATLLVFAALALYQLFKGVHRRTATLMA… |
| A0A069E613 | 2-214 | None |
| A0A7C2HI30 | 1-208 | None |
| A0A3D4NEP7 | 1-222 | None |
| A0A4R9AMM3 | 36-227 | None |
| A0A539D643 | 7-206 | None |
| A0A7K0DC63 | 3-206 | None |
| A0A4Q7MDU2 | 2-203 | None |
| A0A2D9NYW8 | 88-309 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.