DPCstruct | MC716
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 90 ± 7 aa |
| Standard deviation of domain lengths | 7.10 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 32.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B8M3K3 | 22-98 | MSLAPRDTIHASDMDRYNAVMSTVKGSQFLHLYLKDNQVKLDIYEDPSNALVSQNSFAPSENAPKYFEQEEKREEAL |
| A0A4S8T4C9 | 1-102 | MTQQTSPKPLDMCDTIIPSDLPRFIAFVEKEQDPNTYSAYILNDAGNVEFRVHNGDTDDIVEKQEFGDNGMARLFMEQQERLFEEMK… |
| A0A074YJA6 | 56-143 | None |
| A0A1D8NKJ0 | 40-122 | None |
| A0A1L7TYI6 | 2-99 | None |
| A0A1B5L093 | 91-177 | None |
| A0A0L0N2P8 | 1-87 | None |
| G3JP54 | 70-163 | None |
| K3V9W4 | 71-169 | None |
| A0A7S8I892 | 1-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.