DPCstruct | MC7159
Metacluster Properties and Pfam Annotations
| Number of structural domains | 141 |
|---|---|
| Mean domain length (aa) | 164 ± 33 aa |
| Standard deviation of domain lengths | 33.48 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0020- PF14041 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y8ME11 | 5-119 | AGAEAAILAWARAQYGEIFEPLNIFYGDFTGDGAPDAFAWVNYPTGGNSAGLDVPLFRNQGGRMVYWRSEQEVFGEQPRNIAFAPGR… |
| A0A538U8K3 | 19-169 | HASGVTEDTTDIMATARYAGYPMDHLGAGTIQLAGGAYHDSAAGLDVKLIASAKGDVDGDGRPDAAVVLASQTGGTGTFIDLFALLD… |
| A0A7X8TP20 | 10-183 | None |
| A0A170XD88 | 2-109 | None |
| A0A1W7D3X4 | 11-178 | None |
| A0A7Y0L7N2 | 6-205 | None |
| A0A1V1V3U7 | 12-140 | None |
| A0A516X294 | 91-244 | None |
| A0A4Q6GK68 | 3-171 | None |
| A0A7W4ABS6 | 22-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.