DPCstruct | MC7158
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 393 ± 23 aa |
| Standard deviation of domain lengths | 23.24 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 23.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A257K066 | 102-492 | TYVWNKTGTADWTIPTNWTPSRTIVGTADLLVFNNGATCSVSSVASETIAGLSVASNTNVTFTSGANLTISNGVNGADFTVDASSQW… |
| A0A538TZD9 | 31-405 | ATYYSQGSLDPNVTTNWNSIRLGGGSSPANFTSGDVFAIQASHSMATTAAWTVSGAGSKIQIESGGTLTANHIVAVPTFQVDDGGSY… |
| A0A832GV13 | 1-387 | None |
| A0A1M6A975 | 326-762 | None |
| A0A7Y3S1A7 | 469-880 | None |
| A0A4Q2ZN96 | 456-819 | None |
| A0A3S0G1E6 | 30-439 | None |
| A0A1F3D5P8 | 33-402 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.