DPCstruct | MC7157
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 99 ± 12 aa |
| Standard deviation of domain lengths | 11.82 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 20.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H0M7B2 | 1-83 | MNIICKECNKEFEPKQDMLKEKYLGAMITETYFECPNCNKKYLVCINTPKARKLMLDIKNYITLGENIKADKLRKILKIEMDK |
| R8NJV9 | 1-103 | MKTNVTCSHCQHEYKINEIKTKRVTEDIEEHYFVCPECGGEQNCFYVDKVVRKLMQHQKNLRFRLQKATSVKRKQKVWDELQETNEK… |
| A0A4V3RZ22 | 11-103 | None |
| A0A496KCY2 | 30-132 | None |
| A0A3D6DYG5 | 9-106 | None |
| A0A416FW75 | 70-175 | None |
| B0NA24 | 11-93 | None |
| S9SNT2 | 1-87 | None |
| A0A7I8DXZ3 | 11-116 | None |
| A0A429X8E5 | 2-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.