DPCstruct | MC7154
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 171 ± 22 aa |
| Standard deviation of domain lengths | 21.72 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 68.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.85 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 38.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15341 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6PH91 | 1-157 | MKTKSLPARSAPFGDDFRTSKKDKRQIKHATLISKIAKNSKPQKKRRPSKKLVANLESLADALPEAEESHDAASQVNIIKQETLRHK… |
| R7YZ13 | 1-177 | MAPIKPARPSQRSRTTRPSTSLKPRPTFATPDTTFTSSKKDKRTIKHSVFLHKIEKTHSKAPKRRRPNKKLVADLQSLADALPDTID… |
| A0A179I5G2 | 3-140 | None |
| Q4WKK4 | 56-232 | None |
| A0A0D2GPB6 | 40-249 | None |
| A0A420IG66 | 1-171 | None |
| A0A5J5ESN1 | 1-156 | None |
| A0A2B7XAP8 | 1-199 | None |
| A0A6G1KVD7 | 30-210 | None |
| A0A1S8B5M9 | 3-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.