DPCstruct | MC7153
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 213 ± 34 aa |
| Standard deviation of domain lengths | 33.57 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 16.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A370U038 | 1-209 | MATTPDQLFSIKRTIIDYLQDESGATRYIDILGTYSKLDAAKAAARTALTDEGYIKDDFPTYDENDGKKQWTHGDGVIVFAKMGSGQ… |
| R7YYC9 | 1-171 | MAPVSEYLYHVVRTMIDYHHDPSGASQDITVNGTYTDLSAAKKAAKTALFDDGYEEEWFTTFDIKGDPEEWTHGDGNIVYARAPEGE… |
| A0A164LBG3 | 7-217 | None |
| F9GCX4 | 1-168 | None |
| A0A4Z1ID34 | 1-215 | None |
| A0A1B9HWH8 | 1-246 | None |
| A0A6A6Z0S4 | 135-328 | None |
| A0A7C8MS89 | 389-671 | None |
| A0A179GWJ2 | 11-228 | None |
| A0A2T5M7G1 | 1-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.