DPCstruct | MC7152
Metacluster Properties and Pfam Annotations
| Number of structural domains | 151 |
|---|---|
| Mean domain length (aa) | 260 ± 44 aa |
| Standard deviation of domain lengths | 43.80 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 16.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0023- CL0063- CL0374- CL0361- CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V8TNW7 | 4-263 | LDITFADGLQQYSDSVTPPSLDFVMSLPLYVRIKLWAIYLHVLQRSGGETLVYIGSATNAKYGTWSRLESYRKGEALPQYVKQAMDQ… |
| R7YUQ8 | 8-284 | EPLSDLAADQRALEIFSQRLTSTIDTILALPETELGVGWQKEYLGLRSKEEWVEVINVATEHQAKLLLGAERPPTIQQLLQLPRVSE… |
| A0A1B8EJX3 | 6-323 | None |
| A0A1B8EWQ1 | 311-562 | None |
| A0A1V6PFC4 | 182-461 | None |
| A0A1V6PJ76 | 177-400 | None |
| A0A2K0W5Q8 | 5-211 | None |
| A0A5C6T4A9 | 578-847 | None |
| A0A4V1XR96 | 120-307 | None |
| A0A5N6ET53 | 57-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.