DPCstruct | MC715
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 136 ± 16 aa |
| Standard deviation of domain lengths | 15.90 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.91 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | CL0517- PF02312 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D5RMZ4 | 5-116 | ASDQQTSFQTDYFLNQLSHFTEAKFSLFEHAPPAERRDRFRNHVEREEMPLTFCKMGINIPVKLEWSQTSGNEINFRSRPFVFNGIW… |
| A0A1W0WTK1 | 181-328 | KTMPRVVENQREKFEGDAYFRRLSRESEVRYAAVPIERPIEQRRRQFETDVANGFLIVSFLTSGTHMMLTFRNPRNVPEAGPALLIP… |
| A0A3B3DMR7 | 5-142 | None |
| A0A7D9DKM4 | 1-140 | None |
| D3AVZ2 | 13-135 | None |
| A0A3Q4N2B1 | 1-151 | None |
| A0A2K6VJZ9 | 30-158 | None |
| E4XKR7 | 1-141 | None |
| A0A820UJ58 | 7-150 | None |
| A0A498MAS0 | 1-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.