DPCstruct | MC7149
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 206 ± 21 aa |
| Standard deviation of domain lengths | 20.56 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7YJ10 | 1-219 | MADNSDQAAKAASTPSDQQLTERECDARYAIPHAVPYKDPDPPNPINLSVLPMVHHPLSPETDSITTPSWPSQVTPTLAQVFAGVVA… |
| A0A0F8CZ21 | 1-163 | MSTSQQREFQEQFYDALEIYSPEPEVCDKEIQPKDLITAKLHQVSADLNIIDRFKFKTSRKVESLERGFWLIDTSEWQMPLREAAWK… |
| A0A163JBS8 | 552-754 | None |
| A0A4T0WDA0 | 21-213 | None |
| J3P9U5 | 170-392 | None |
| A0A6A7AFC3 | 275-450 | None |
| A0A4Z0YSE4 | 57-262 | None |
| A0A2C5XSH7 | 83-305 | None |
| A0A0D2BN85 | 38-254 | None |
| A0A4T0BNR5 | 489-723 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.