DPCstruct | MC7148
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 70 ± 9 aa |
| Standard deviation of domain lengths | 8.99 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 62.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08507 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S6CLS9 | 833-887 | MFSFIGRGIFYIFVGCIQMGDRWWKYLSGALVVFVGIAYVVLEFTPSIEPPANMR |
| R7YG63 | 1-55 | MFSFIGRGVFYIFIGSVIVGDRWWKYTSGALIGLVGLAYVVLEYIPSIEPPANMR |
| U1HZX6 | 318-395 | None |
| A0A0C9M0L4 | 1-55 | None |
| Q5BH05 | 364-440 | None |
| A0A1B7YJZ2 | 191-272 | None |
| A0A5N6K5T7 | 53-119 | None |
| A0A1M3U149 | 217-293 | None |
| A0A3M6ZB62 | 1-63 | None |
| A0A367XQP6 | 103-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.