DPCstruct | MC7147
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 73 ± 7 aa |
| Standard deviation of domain lengths | 6.99 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 28.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13511 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P0THG2 | 26-91 | AAPGGAVELYRYVNDKGVVVLDRQGVPPQYIGKGYQVLNDQGRVIRTVPPAPTAEELRQRKAAQAQ |
| A0A424RFH0 | 4-78 | RLAIVVMLALLSSYAFSDNLCRYKNDVGGTVVDWHVPAKFAGRGYQVLNSQGQVIEVVPRQLSEGELQNKDLVER |
| A0A849UGY9 | 21-88 | None |
| A0A3C0TC69 | 17-83 | None |
| A0A2E5C8E0 | 49-133 | None |
| A0A222FGH7 | 3-68 | None |
| A0A0M1J719 | 8-88 | None |
| A0A5M8FV94 | 101-170 | None |
| A0A853IFM0 | 12-88 | None |
| A0A1E7RF34 | 20-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.