DPCstruct | MC7146
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 175 ± 17 aa |
| Standard deviation of domain lengths | 17.24 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 57.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N2C018 | 1-206 | MCQLFSVQRQSLIKLPPLQRTKGEKASYCLACLFSLIEQARYLQFRKWPAEWGWCRDLRSFIFVFERHNRIVLEHPEYGYATYFFEL… |
| A0A1D1XJW9 | 694-866 | TKGTKSVYCLACLISLIEQTRYLRFRNRPVEWGWCRDLQSFIFVFKMHNRIVLERPEYGYATYFFELVESFPIDWQIKRLVTAMKLT… |
| A0A7N0SZZ6 | 338-507 | None |
| A0A061RYB6 | 128-295 | None |
| A0A2R6R643 | 250-402 | None |
| A0A834Z3L0 | 853-1017 | None |
| A0A1D6PGT1 | 103-275 | None |
| A0A4Y7JP44 | 331-537 | None |
| A0A835HJC6 | 319-524 | None |
| A0A7S1T0Z5 | 116-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.