DPCstruct | MC7145
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 122 ± 15 aa |
| Standard deviation of domain lengths | 15.39 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 49.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09187 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N9IPI4 | 2-119 | VEQAKKYQEYMKQIPVPPTRGSGSDVVFITWEGLAKSMKELYGQPLHYLTHVLVKQWDQSRIGTEDEDTPMDNIINPFKAEATIWDV… |
| A0A6N2B8Z0 | 6-124 | LGVILRKAKMYQEYMQMVPIPARKASVIPCNSWTGLAASIKGLYGQPLHYLTNLSVKKWDSLRIGASDEDVPLDILIDPAKAEAGIW… |
| A0A438JY65 | 22-141 | None |
| A0A1E5VAT0 | 223-343 | None |
| A0A5C7IJC2 | 20-134 | None |
| A0A0L9TDF9 | 45-185 | None |
| A0A396HJ30 | 168-304 | None |
| A0A6P5TMA9 | 129-253 | None |
| A0A822ZW65 | 1-88 | None |
| A0A6A1W0M8 | 83-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.