DPCstruct | MC7144
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 89 ± 8 aa |
| Standard deviation of domain lengths | 8.04 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R2F300 | 87-172 | DRSESIAVRDFDDTEVTYNFKFPGFQRIIKLQAEATADDGSLMTAEYYKGLMKHVITNEEVNFSYWDHHEGYTEVMQEADLFIGTI |
| A0A5M9EIR7 | 27-120 | EVAKPVSKFGQQKEVEIKRADGGVDKYLLQYPGIRKAMEIIDNSTMPNGQLARSIFADQLLEHVVVQPANLSLDDFDEREGINQLVD… |
| A0A7U0R4A2 | 3-89 | None |
| A0A349YQ69 | 25-110 | None |
| A0A660E1A6 | 57-144 | None |
| K2FH93 | 33-114 | None |
| A6TKD9 | 1-81 | None |
| A0A7Z0PRZ4 | 5-83 | None |
| A0A398BI10 | 11-100 | None |
| H6NDT6 | 2-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.