DPCstruct | MC7143
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 149 ± 18 aa |
| Standard deviation of domain lengths | 18.18 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01161 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C4WVW6 | 72-213 | SEKIDLANRTFSTFDFYCSHEDIITPAGLAFYQTDWDNSLTKFYHDQLSMPEPVYEYDFQPPYIKPQKWFPLKEPFNLYMDKYRDEK… |
| W8BPX6 | 24-162 | SNNLEKRTFRTLDFYREQQENITPAGLAFFQSDWDTSLTKFYHNVLNIKEPIFEYDFPKPYLADQKFFPLKQAFNLYLDRYRDPRDV… |
| A0A819Y3W4 | 1-142 | None |
| A0A6A7FPM4 | 5-144 | None |
| A0A6L5CQE8 | 206-349 | None |
| A0A816XJS8 | 63-202 | None |
| A0A6V7VVZ2 | 106-256 | None |
| A0A4C1XFZ9 | 130-271 | None |
| A0A315VDR8 | 1-110 | None |
| A0A6L2PPQ6 | 193-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.