DPCstruct | MC7141
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 138 ± 19 aa |
| Standard deviation of domain lengths | 18.82 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 28.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08628 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8DZM7 | 2-106 | FVYYINLFRDAFWPHGKLAPPTDIRSEEQSQETKQRAQQKLLENIPDMLQSLVGQQNARHGIIKIFNALQETRANKHLLYVLMELLL… |
| W8AYQ5 | 1-135 | MGGVFKWLRKSLISFVQITYGRTINRQIRESVAYLFEESMLHYYFSAILKSFWPGGVLASSYPVRSDDIKEMTRNAAKDLLMDHIPE… |
| A0A7S2LT90 | 987-1142 | None |
| A0A814VCG0 | 2-122 | None |
| G1Q9Z0 | 2-120 | None |
| A0A5K4ER96 | 675-860 | None |
| A0A4W3HE17 | 698-847 | None |
| G8BC58 | 612-778 | None |
| A0A7R9U660 | 380-512 | None |
| A0A034VJM8 | 569-722 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.