DPCstruct | MC714
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 93 ± 10 aa |
| Standard deviation of domain lengths | 10.40 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 69.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 49.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10235 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W0WSV6 | 139-231 | VCDKCQTKLGKVITPDPWKSGARNTTEGGGRKVNENKALTSKKARFTPYEKFEKCKICKVTVHQVGSHYCQPCAYKIGICAMCGKKM… |
| A0A821P0Y1 | 1-78 | GSRNTVESGGRKLNENKLLSGKSTRYSPYTTKFSKCKVCKGSIHQPGSTYCQGCAYKLGICGMCGIKILQTKNYRQSS |
| A0A1S8W8B7 | 1-95 | None |
| A0A811R786 | 146-236 | None |
| A0A7D8Z1C0 | 2-103 | None |
| A0A6L5CRY2 | 85-173 | None |
| A0A1W0A2U0 | 2-96 | None |
| A0A7N4NFZ2 | 2-97 | None |
| A0A0R3QK50 | 7-107 | None |
| A0A5J5CHS8 | 132-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.