DPCstruct | MC7137
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 360 ± 45 aa |
| Standard deviation of domain lengths | 44.79 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G6EDD0 | 53-391 | RSESAASDMLQMLFNSSKLLDYVAERRPYFGLALIRHQVYGAADFSERFLSRLIASPGSALYHELATNLVTDGPVAYALPIRNRLLH… |
| A0A2D5RZ93 | 2-300 | VATKATLLRLNDSEEYISSFFTSLIAHPGSVLYRELRDNQNCSYTGEYYLDESNELLNFYLSDISNAQYVRIWKPIADYVIDYIKQQ… |
| C4KRZ9 | 10-329 | None |
| A0A519JA46 | 102-513 | None |
| A0A7D3Y2Q5 | 214-585 | None |
| A0A0H4PV26 | 118-476 | None |
| A0A4U7F737 | 53-401 | None |
| A0A0Q8QGN7 | 31-483 | None |
| A0A523DY47 | 12-345 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.