DPCstruct | MC7136
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 63 ± 5 aa |
| Standard deviation of domain lengths | 5.00 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 94.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 68.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17391 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A533ITB7 | 5-64 | REVRAPRGTELSAKSWQTEAPLRMLMNNLDPEVAERPEDLVVYGGTGRAARSWEAFDAIV |
| G6E961 | 3-61 | RLDNSRRIVLATGTERTAQSWLTEAPLRMLMNNLHPDVAERPEELVVYGGIGRAARDWE |
| A0A535YS62 | 474-529 | None |
| I4WGG0 | 1-70 | None |
| A0A090TA17 | 12-77 | None |
| A9WN96 | 231-300 | None |
| A0A3D9TYU3 | 8-65 | None |
| A0A1Y5RE61 | 293-360 | None |
| A0A0L0GEV6 | 1-69 | None |
| T1ABY9 | 5-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.