DPCstruct | MC7133
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 84 ± 4 aa |
| Standard deviation of domain lengths | 3.59 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 89.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 46.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19422 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A261XX87 | 73-156 | WTYAFAFYLQKNNQTEIFEDNQRDLEMATEQLSELLEKPIVRSQIADLRQLVLDKSVYVGTRREILLEDTTKGLLEGRWEYIVS |
| A0A1S3AQY5 | 1-85 | MYTYVFAFYLKKNNQSIIFENNQADLENATEVLSGYLERDISQDSLQDIKQKVQDKYRYCESRRRVLLQHVHEGYEKDLWEYIED |
| G0NKE9 | 53-138 | None |
| A0A4Y9ZTR8 | 152-235 | None |
| A0A814V0H5 | 125-209 | None |
| A0A820J365 | 44-125 | None |
| A0A822EQL9 | 92-179 | None |
| A0A7R9GK01 | 512-595 | None |
| A0A6A5HIN5 | 686-767 | None |
| A0A2Z6S1A4 | 1010-1093 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.