DPCstruct | MC7132
Metacluster Properties and Pfam Annotations
| Number of structural domains | 415 |
|---|---|
| Mean domain length (aa) | 94 ± 14 aa |
| Standard deviation of domain lengths | 14.33 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 32.67 |
| Pfam Score | 97.99 |
| Assigned Pfam label(s) | PF08685- PF00057- CL0124- CL0602- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q96SE8 | 64-151 | IDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKLLVQECMVHDC |
| A0A1S3AP75 | 23-116 | TVVQECYYGNGQNYRGSMATTVTGRTCQCWSSMTPHQHQRTPENYPNAGLTHNYCRNPDGDPRPWCYTTDPTVRWEACNLTQCSEPE… |
| A0A7R9A7Y1 | 11-110 | None |
| A0A7R9A7U2 | 112-205 | None |
| A0A7R9A7M0 | 2-102 | None |
| A0A7R9A7C9 | 50-155 | None |
| A0A7R9A7B8 | 352-454 | None |
| A0A7R9A7A7 | 6-116 | None |
| A0A7R9A736 | 276-385 | None |
| A0A7R9A6N1 | 7-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.