DPCstruct | MC7131
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 117 ± 14 aa |
| Standard deviation of domain lengths | 14.45 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 49.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C9U3Z1 | 26-140 | MDSQGNNARKKNLMTKVDSAKAKLDEIAQRKSELATQNKVKQSIEQVRCKAKEFKPELLAMDIKTLEEEYKALLSDKAGEFEYLQSL… |
| A0A151RA41 | 35-150 | NIRTLEKDIDLAKSGITQFKEDSEKMKAVKGEICSKILEKQKRIASLEFDISKLSQPELKAADVTALEEEYNALLSDKAGETEYLRS… |
| A0A2P5FBL7 | 112-226 | None |
| A0A6A4NZ97 | 1-115 | None |
| A0A0S3TDT6 | 72-205 | None |
| A0A2K3P1A0 | 134-258 | None |
| A0A822Z633 | 4-88 | None |
| A0A6P5G3V5 | 165-277 | None |
| A0A438KPN4 | 19-128 | None |
| A0A6G1CKW2 | 62-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.