DPCstruct | MC7130
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 156 ± 13 aa |
| Standard deviation of domain lengths | 12.74 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 67.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 55.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A251J667 | 1-172 | MTTSSFFLVKLMDEGKAFGGGPRELGGAVDLINQYKLWPHHELFCKRSLPLSISETHYFRNVVGDTQIRKGEGMELDQLFHNASYLR… |
| A0A3B6TZC3 | 4-162 | DDKKFGKGPRELTGAVDLISQYKLEPHHDFFCKRPLPLAISDTHYLHNVVGDTEIRKGEGMELDQLVQNAYLRDKPPSIKPFDMETL… |
| A0A1Q3C7Z3 | 47-201 | None |
| A0A2K1L098 | 27-182 | None |
| A0A803L866 | 55-197 | None |
| A0A0R0K5X4 | 6-158 | None |
| A0A3B6LSP6 | 7-155 | None |
| A0A0V0IDJ0 | 1-141 | None |
| A0A835KG38 | 96-260 | None |
| A0A314UXZ8 | 7-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.