DPCstruct | MC713
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 208 ± 25 aa |
| Standard deviation of domain lengths | 24.71 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 32.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05600 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453RFH8 | 17-187 | RDPAEIRSLPIDIAFARLQEWLVDRKRVPQDWRKRLAAIRARLAAAFSSLPRDLHPYLQTLELEEIGYLEAKKIYSILLESNTDSRN… |
| A0A1W0WNL1 | 2-234 | ASGDAQNIPIDIHLGQLSDWIVTRRHCPKDWIVNLQKIREKLAVLYPAVLTALPNLSVETEGLPQLASELTYLHCKTLSQALADTTE… |
| A0A812DMY1 | 61-275 | None |
| A0A6S7NP75 | 587-812 | None |
| K1PYW7 | 1-205 | None |
| A0A7S3T2J0 | 15-281 | None |
| A0A7R8D7Z6 | 7-175 | None |
| A0A0F8AC49 | 172-383 | None |
| E4Y0Y0 | 4-217 | None |
| A0A812R935 | 2-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.