DPCstruct | MC7129
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 107 ± 16 aa |
| Standard deviation of domain lengths | 16.22 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 36.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q7AQ39 | 1-102 | MAHHNAHAAPAFLWSGLVSAAVLIADGRGEDTYLPIISIYLARGNELKPNPLLSVIYVEHLLVLFYQSVGDHCGFGRYDFGKTMVLA… |
| A0A800ES41 | 128-232 | HHLAHTASAYFMSDWEESAGFTLDGSGDFATCLMSKCEGSEIKPLYRVNVPHSMGSLYMMICDFIGYKKYGDEGKVMGLAPLGKDSY… |
| A0A561TPB1 | 4-103 | None |
| A0A4R3S3A6 | 130-234 | None |
| A0A662QS07 | 27-179 | None |
| A0A2H0NDK8 | 120-229 | None |
| A0A537L050 | 175-280 | None |
| C4KG95 | 55-147 | None |
| A0A3D0R3A0 | 158-263 | None |
| A0A176S4G5 | 127-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.