DPCstruct | MC7128
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1779 |
|---|---|
| Mean domain length (aa) | 436 ± 81 aa |
| Standard deviation of domain lengths | 80.87 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.37 |
| Mean intra-cluster sequence similarity (%) | 12.92 |
| Pfam Score | 81.86 |
| Assigned Pfam label(s) | PF21436- CL0020- PF04081- CL0316- CL0329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A525K0S1 | 61-391 | VRQNWENVYETESDKFDRDAEGHPLPRLRPGQTEPIPGHPEYSTHPPGMALLVAPILYPFRHTEFVEPMAIVCSTFAVIIAFFLFRS… |
| A0A5Q4EDZ7 | 20-427 | YATSVFFLSLAIFFWRLGAGHLQDWDEAIYAEVSKNIIERNDWMTLFWGDSPWFHKPPLFMWSTAVLFKIFGISEFSARAASAIAGI… |
| A0A1D9FJT3 | 57-479 | None |
| A0A2D6PY26 | 183-630 | None |
| A0A2R7YBE8 | 83-622 | None |
| A0A1X6PFH3 | 12-425 | None |
| A0A1G1A4F1 | 12-431 | None |
| A0A1Q6XDR4 | 373-978 | None |
| A0A7V2U8B2 | 41-497 | None |
| A0A7S2S1W0 | 30-455 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.