DPCstruct | MC7126
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 125 ± 15 aa |
| Standard deviation of domain lengths | 14.71 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N8RXS3 | 13-135 | AAVGAAAQSAATVTSVEVFANSATHVRAQQNSPYALRVFRLDAMAQISQQMSIRLPMDEAQAKAYMLQQEANIRARYKDQIVNAANG… |
| A0A7T1P0X9 | 1-130 | MKPNLILISLAALVVSQTSAAVPWVITDSAPAIEATNEIRLILIDQLSALEDEVSSGLPSSPDAAEAMFGERMTAQMSAKIENAHQD… |
| A0A250KLK0 | 63-173 | None |
| A0A7C5J4M1 | 79-220 | None |
| A0A6L7SVN6 | 55-171 | None |
| A0A2E7C8T3 | 27-172 | None |
| A0A2S5AKU9 | 62-202 | None |
| A0A029I416 | 2-94 | None |
| A0A6L8G5E8 | 236-368 | None |
| A0A378KIF7 | 1-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.