DPCstruct | MC7125
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 389 ± 22 aa |
| Standard deviation of domain lengths | 22.05 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 23.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13886 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A226E767 | 71-463 | VTISFTSTPTVGQSVKGSSVGLVLNGTEKSDVFVINDNDLELNVLLLLQTYDDSAPIPGGCNMEEPVKTAPYLPTSFTPNLVVVEYP… |
| A0A2J8QQX4 | 1-382 | MAILLSYSERDPVPGGCNLEFDLDIDPNIYLEYNFFETTIKFAPANLGYARGVDPPPCDAGTDQDSRWRLQYDVYQYFLPENDLTEE… |
| A0A1I8GNQ0 | 317-730 | None |
| A0A0P4W5G2 | 284-683 | None |
| A0A6F9DVG8 | 77-501 | None |
| A0A212CCV0 | 1-369 | None |
| A0A7J7K0C0 | 6-379 | None |
| A0A7R9L524 | 108-462 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.